PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG121900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 134aa    MW: 14692.5 Da    PI: 6.9327
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG121900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB101.65.9e-3223115597
                NF-YB   5 drflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                          ++ +P a v+rim++  P n+ i+ dake v++c +ef + + + a + c+++kr t++gddl+ ala+lGfedyv pl +yl++yre+e
  Pavir.4KG121900.1.p  23 EHRIPRATVARIMRHGSPPNSTITGDAKEAVDNCLVEFCAVLIAAAVEECRQDKRTTVTGDDLILALANLGFEDYVRPLALYLRRYREIE 112
                          6779************************************************************************************** PP

                NF-YB  95 gek 97 
                          g++
  Pavir.4KG121900.1.p 113 GNR 115
                          986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471134.04E-2622119IPR009072Histone-fold
Gene3DG3DSA:1.10.20.105.4E-2922122IPR009072Histone-fold
PfamPF008082.7E-152589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MDKNQANNLR EGARAGTDHA PEEHRIPRAT VARIMRHGSP PNSTITGDAK EAVDNCLVEF  60
CAVLIAAAVE ECRQDKRTTV TGDDLILALA NLGFEDYVRP LALYLRRYRE IEGNRPRARH  120
SSMAAAQGPT APAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B4e-25261101094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-25261101094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966907.11e-54PREDICTED: nuclear transcription factor Y subunit B-1-like
TrEMBLK3Y1039e-56K3Y103_SETIT; Uncharacterized protein
STRINGSi007865m3e-55(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140561326
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.55e-33nuclear factor Y, subunit B1